<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1" xmlns:xhtml="http://www.w3.org/1999/xhtml" xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://supperstudio.ca/home</loc>
    <changefreq>daily</changefreq>
    <priority>1.0</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500058415985-12TXY32SPNI5JG0U4J9E/SS_NewsletterBackground.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1e5868d8-5c96-4c88-a908-369fcc36c80b/currentmealtab-2.jpg</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521997577373-DXH8ANVSZ37P8D0EEUCM/order-now.jpg</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/0cef0df4-7693-4d73-8ae1-260367bc62b4/downloadfreezermealrecipe.jpg</image:loc>
      <image:title>Home</image:title>
      <image:caption>Easter Survival</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/34ff5517-09c1-4d73-9ee5-e1c7fdd54f5a/IMG_7188.jpg</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/8c18d0e0-d1f8-42ff-85dc-9d133c890d80/stack.jpg</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521996697092-BPC4KABA51E1FYH9KZ0K/supper-studio-gift-certificate.png</image:loc>
      <image:title>Home - give the gift of supper</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/about</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2024-05-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500349606949-G2OT9Q4OGS0UIZYT1UV8/SS_AboutBackground.png</image:loc>
      <image:title>Our Story</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1619291398314-FBZ3PN5T8B34ZU5OI9I9/Leah%2Bfamily%2Bphoto.jpg</image:loc>
      <image:title>Our Story - About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1619291143549-B84HZH2IAY66QTW1M5YQ/IPBA-8281.jpg</image:loc>
      <image:title>Our Story</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1501205654604-62S7AX66GE0GURRI92HN/image-asset.png</image:loc>
      <image:title>Our Story</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6811d1c2-7bf0-467f-9204-82555c5c680b/SupperStudio-170.jpg</image:loc>
      <image:title>Our Story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/9fe10e21-7f98-42af-8553-dc2142c0a000/SupperStudio-174.jpg</image:loc>
      <image:title>Our Story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/how-it-works</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-22</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500058415985-12TXY32SPNI5JG0U4J9E/SS_NewsletterBackground.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500063282469-7QOE02EP7S598IM3ZXHV/image-asset.jpeg</image:loc>
      <image:title>How it works - How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1501205755146-P2KAHEOT02J043OLLXPM/image-asset.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1501296870562-1QKT5IQ68RAOUT00T7RV/image-asset.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521957733034-8HHX7YTLY2A6HQS168BN/date.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521957714602-MM72M5BFNY12XHCSKQ6R/food+icon.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521957750494-G1KIQ837T8WZOQV374YH/money+icon.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521957782799-FFSEZ0FTWPTU4QE0IUKH/bag+icon.png</image:loc>
      <image:title>How it works</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521996697092-BPC4KABA51E1FYH9KZ0K/supper-studio-gift-certificate.png</image:loc>
      <image:title>How it works - give the gift of supper</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-14</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2026/3/30/9ldg174acywoxdvtvwr05imbplixlx</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-31</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/056bd83c-a601-4d08-ae58-eba5e26ad642/IMG_0381.JPG</image:loc>
      <image:title>Supper Studio Blog - Meal Prepping Tip: Batch Cooking your Protein! - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/9/8/cheesy-zucchini-quiche</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-09-10</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1662815898151-1PWLLKADRRH93XAS2NI7/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Cheesy Zucchini Quiche - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/f2e2f25b-0b18-40f5-aa00-9dc945555e3d/zucchiniquiche.jpg</image:loc>
      <image:title>Supper Studio Blog - Cheesy Zucchini Quiche - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/9/8/mason-jar-peach-crisp</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-09-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1662666516550-ZGD5MJIHSG96XTFGE43L/unsplash-image-O3TlS547j7k.jpg</image:loc>
      <image:title>Supper Studio Blog - Mason Jar Peach Crisp - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/f6b67160-285a-428a-bf1e-859a3f0c9dfe/peachcrisp2.jpg</image:loc>
      <image:title>Supper Studio Blog - Mason Jar Peach Crisp - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/quick-summer-salads</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-07-21</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/39ca07b9-7ec9-4c97-bac2-ef6e83cdd16b/potatosalad1.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/0ef8d5ac-477e-4c7f-ab31-c81dfc9173cc/blackbeanandcorn1.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/37f945b2-eecd-42d1-9776-5bc011c84326/potato.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/0dd18b56-8b45-4776-986e-76729e58dc33/roastedpotato.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/b6e788ae-72cd-4618-8d95-7b6244a68abe/potatosalad2.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/36adac01-7d8b-43ed-b586-035a25414c1e/instantpotblackbean.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/e48a239a-6bc1-4369-9c54-a31a654ec204/blackbeanandcorn.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/a56d51ca-6c87-4da3-b52f-f9e7c573776f/blackbeanandcorn2.jpg</image:loc>
      <image:title>Supper Studio Blog - Quick Summer Salads - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/7/12/easy-4-ingredient-no-knead-bread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-07-17</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/052e5349-557e-421b-b823-0b7563fefbab/artisanbread1.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/68cfe8a8-33eb-431a-82e6-92208729940b/artisanbread2.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6131ec62-0481-45fa-ac4e-2c731a02ce64/artisanbread.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>1. Mix together the flour, salt and yeast.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/77bff24c-b41d-4d0b-b13c-055731f8c9ec/artisanbread4.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>2. Add water and incorporate to create a dough.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/290c61ee-fbd7-4812-bc70-31cc321a1580/artisanbread5.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>3. The dough should be covered tightly and allow to rise anywhere from 2-24 hours. This is after it has risen and been taken out to form a loaf.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/51af2a48-5037-49e8-bd22-b995f6126379/artisanbread6.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>4. Lift the loaf into the pot, cover and bake for 30 minutes. You can cut a design on top if you wish.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/8adad18a-911b-447f-a0e7-84bf95729cca/artisanbread7.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy 4 Ingredient No Knead Bread - Make it stand out</image:title>
      <image:caption>And there you have it. A beautiful loaf perfect for sandwiches or anything your heart desires. Enjoy!</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/1/20/meal-prep-do-your-future-self-a-favour</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-06-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1642704998956-83LVIE31XR9QT3KNI6IB/mealpreptips.jpg</image:loc>
      <image:title>Supper Studio Blog - Meal Prep. Do Your Future Self a Favour! - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1642705412921-2THCJ24SUH9A0ZO4FAED/cauliflower+rice.jpg</image:loc>
      <image:title>Supper Studio Blog - Meal Prep. Do Your Future Self a Favour! - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/1/25/easy-suppers-for-on-the-go-families-slow-cooker-meal-series-4</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2023-11-05</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629202682197-67HMTRQNB5GSOCLKKX9E/pulledpork.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy Suppers For On-The-Go Families: Slow Cooker Meal Series #4 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/1/25/easy-suppers-for-on-the-go-families-slow-cooker-meal-series-3</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2023-11-05</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/a072f4d3-04ed-4422-bd64-78b83a5d1593/meatballsausagesub.jpg</image:loc>
      <image:title>Supper Studio Blog - EASY SUPPERS FOR ON-THE-GO FAMILIES: SLOW COOKER MEAL SERIES #3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/1/20/easy-suppers-for-on-the-go-families-slow-cooker-meal-series-2</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-03-05</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1617225738667-XTESL552Z6YYHHZWGXI1/butternutsquashchili.jpg</image:loc>
      <image:title>Supper Studio Blog - Easy Suppers for On-The-Go Families: Slow Cooker Meal Series #2 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2022/1/10/10-things-you-didnt-know-you-could-freeze</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-01-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/5cfd02cd-d1d2-40f2-8668-ea399f07fe6d/phonto+%281%29.JPG</image:loc>
      <image:title>Supper Studio Blog - 10 Things You Didn't Know You Could Freeze... - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/4/29/the-only-chocolate-cake-recipe-youll-ever-need</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-09-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1631706890147-8WYZEB6M2QLBW1Z64JR2/unsplash-image-2UeBOL7UD34.jpg</image:loc>
      <image:title>Supper Studio Blog - The Only Chocolate Cake Recipe You'll Ever Need</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1631821927647-FLFFXH8AISWY4XIC8FUC/chocolatecupcakes.jpg</image:loc>
      <image:title>Supper Studio Blog - The Only Chocolate Cake Recipe You'll Ever Need - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2021/8/15/the-endless-possibilities-of-shredded-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-08-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629288928761-B336KAXTFS2OZI0TPR9D/ChickenPestoPanini.jpg</image:loc>
      <image:title>Supper Studio Blog - The Endless Possibilities of Shredded Chicken - Make it stand out</image:title>
      <image:caption>Chicken Pesto Panini - recipe available in store!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629289468065-3MFG3IIPGZT7LU364DPA/ChickenParmesanPasta.jpg</image:loc>
      <image:title>Supper Studio Blog - The Endless Possibilities of Shredded Chicken - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2021/8/23/lunch-kit-planning-guide</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-08-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629807591289-GJ511T3LXRF9DLVVW8WH/lunchtimeschoolpic3.jpg</image:loc>
      <image:title>Supper Studio Blog - Lunch Kit Planning Guide - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629807933489-HV3A9WKP4HPCSMYXR89U/shreddedchicken.jpg</image:loc>
      <image:title>Supper Studio Blog - Lunch Kit Planning Guide - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629807720087-725F7NP30OMSW3CAKBIH/lunchtimeschoolpic2.jpg</image:loc>
      <image:title>Supper Studio Blog - Lunch Kit Planning Guide - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629807440148-EIFCL5KQ8O5W5NJLS7X9/weeklymealplan.JPG</image:loc>
      <image:title>Supper Studio Blog - Lunch Kit Planning Guide - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2021/5/7/momhacks</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-05-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1620564857704-BRJZ4AD7BWP1OBK7OTUD/IMG_2215.jpg</image:loc>
      <image:title>Supper Studio Blog - #MomHacks</image:title>
      <image:caption>Rachel Joyce Photography</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1620565041400-IAVUTOFGHDULXXM07HVL/momhacks.jpg</image:loc>
      <image:title>Supper Studio Blog - #MomHacks</image:title>
      <image:caption>Rachel Joyce Photography</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1620565275463-JST2PEBNP4FE8RUV2V98/Momhacks2.jpeg</image:loc>
      <image:title>Supper Studio Blog - #MomHacks</image:title>
      <image:caption>Rachel Joyce Photography</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1620565863602-4AQZMF4UPWWHN2V8FF5G/momhacks3.jpg</image:loc>
      <image:title>Supper Studio Blog - #MomHacks</image:title>
      <image:caption>Rachel Joyce Photography</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2021/1/1/breakfast-burritos</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-01-03</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609694777870-8PZVG9SMLB2RH1142R3F/breakfastburritos.jpg</image:loc>
      <image:title>Supper Studio Blog - Breakfast Burritos</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/12/29/the-lost-week-meal-ideas</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-12-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609268853714-CAZLD5ENEZKIS0791Y2E/tuscangnocchi6.jpg</image:loc>
      <image:title>Supper Studio Blog - The Lost Week Meal Ideas</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609269540904-4UJ2AVDMGZEIQZBJQHWK/Tuscangnocchi2.jpg</image:loc>
      <image:title>Supper Studio Blog - The Lost Week Meal Ideas</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/9/13/cailyns-cancer-story-part-1</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-09-13</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1600004545165-QJU7B2D70J3NIH393V3F/farm.jpg</image:loc>
      <image:title>Supper Studio Blog - Cailyn's Cancer Story - Part  1</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1600005174099-JCOZLB230SBBWMGPD716/arizona.jpg</image:loc>
      <image:title>Supper Studio Blog - Cailyn's Cancer Story - Part  1</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1600005312678-82R0VXOUXAXLR06I7XZ3/arizona1.jpg</image:loc>
      <image:title>Supper Studio Blog - Cailyn's Cancer Story - Part  1</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1600005665975-MR2ZK0BW4G38CTX5LB7L/hospital1.jpg</image:loc>
      <image:title>Supper Studio Blog - Cailyn's Cancer Story - Part  1</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/3/5/meal-plan-week-fifteen</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-03-08</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1583451900039-XE5HB63HWB33T4LI7W9F/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Fifteen</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/2/29/meal-plan-week-fourteen</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-03-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1583041152618-QLJ75NK0X0BOCKBHFBQO/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Fourteen</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/2/11/meal-plan-week-twelve-r3gme</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-02-22</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1582391943238-FSIIDOH40XHKT5A965XK/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Thirteen</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/2/11/meal-plan-week-twelve</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-02-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1581460174289-YJZW2ROL994Y5BQA3EA6/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Twelve</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/1/26/meal-plan-week-eleven</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-01-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1580053014094-WXHB33VHFA1ZQQ2IP4VE/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Eleven</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/1/18/meal-plan-week-10</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-01-19</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1579408289954-3IQFRDA8BE1W6ZB34827/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week 10</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2020/1/11/meal-plan-week-nine</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2020-01-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1578768044115-EPG61OZQBL30Z9MBWWZW/image.jpg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Nine</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/12/1/meal-plan-week-eight</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-12-14</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1575216586691-WDEWO4TA9NC1G9LN7PZC/image.jpg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Eight</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/12/1/meal-plan-week-seven</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-12-08</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1575848417134-XW3ZCPLL8KHKJ4752FIR/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Seven</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/11/21/meal-plan-week-six</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-11-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1574367838908-0ALPEPXNLC17TT20JF02/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Six</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/11/17/meal-plan-week-five</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-11-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1574010418587-PI9P937DZPZIO4MCUZG4/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Five</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/11/10/meal-plan-week-four</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-11-10</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1573411281170-5QP9UU6P92I403N8U866/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Four</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/10/28/meal-plan-week-3</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-09-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1572285170089-6FJC4ZG8MWDJRXDVJ0X3/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week 3</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/10/20/meal-plan-week-two</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-09-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571622257995-WTQ3TSB23BUKPCEEF4C2/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Two</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571622123396-DTKG0QYCJP8YB4CJIVKK/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week Two</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/10/19/meal-plan-week-one</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-09-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571549640590-4SOQ2WBN8CWFZGI54WSV/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week One</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571548614986-GTMSITAHXMJWSS1PVKP0/Farmer-Sausage-300x145.jpg</image:loc>
      <image:title>Supper Studio Blog - Meal Plan Week One</image:title>
      <image:caption>This is the beautiful sausage I buy to make with perogies. My Mennonite MIL steams it in a little bit of water, but my non-mennonite mother bathes it in BBQ sauce and bakes it. Both equally delicious.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/10/14/turkey-pot-pie-freezer-meal</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-10-14</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571068837375-IWSK4IBO0K41VFV49U4N/IMG_0943.jpg</image:loc>
      <image:title>Supper Studio Blog - Turkey Pot Pie Freezer Meal - Happy Thanksgiving!</image:title>
      <image:caption>It’s Thanksgiving weekend and we have eaten turkey dinner TWICE! If your mom is anything like mine, she probably cooked a turkey twice the size of what was needed and now there are leftovers, like, A LOT of leftovers. Turkey Pot Pie is a really great idea for leftover turkey, and if you have enough, double the recipe and throw them in the freezer for one of your really busy days (read: everyday).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1571069826217-1EQ0TLK75HBJIO6UO4NQ/IMG_0289.JPG</image:loc>
      <image:title>Supper Studio Blog - Turkey Pot Pie Freezer Meal</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/3/13/one-week-meal-plan</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2021-09-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1552527679638-31XPJ81B8IG5FYXHL9JN/IMG_2127+%281%29.JPG</image:loc>
      <image:title>Supper Studio Blog - Supper Studio's Meal Plan for a Week</image:title>
      <image:caption>Chicken Stir Fry. Photo by Rachel Joyce Photography.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1552508297368-HMOMUAGSCKMKR7F6D2ZX/image-asset.jpeg</image:loc>
      <image:title>Supper Studio Blog - Supper Studio's Meal Plan for a Week</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/2/22/gimme-all-the-mexican</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-02-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550896111532-CNCADEL847GMQTQPWQPO/IMG_1929.jpg</image:loc>
      <image:title>Supper Studio Blog - Gimme ALL the Mexican...</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550896316782-FQXHOCI185YKHH47DIXY/IMG_1911.jpg</image:loc>
      <image:title>Supper Studio Blog - Gimme ALL the Mexican...</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550897578039-4YN9C49Z5GT14D31688U/IMG_1938.jpg</image:loc>
      <image:title>Supper Studio Blog - Gimme ALL the Mexican...</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550898013997-MTHOZKBYDB73Y1TO1OI8/IMG_1934.jpg</image:loc>
      <image:title>Supper Studio Blog - Gimme ALL the Mexican...</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550898506667-I2BVGHM35SJVU3D8NSR1/IMG_1942.jpg</image:loc>
      <image:title>Supper Studio Blog - Gimme ALL the Mexican...</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2019/2/19/the-ultimate-gingersnap</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2019-02-19</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550597461082-WRG73XISWFHNLHY6J8XP/IMG_1902.JPG</image:loc>
      <image:title>Supper Studio Blog - The Ultimate Gingersnap</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1550597767096-BC5LEHM3FGI57DV11E0A/IMG_1899+%281%29.jpg</image:loc>
      <image:title>Supper Studio Blog - The Ultimate Gingersnap</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/4/29/why-we-do-what-we-do</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-06-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1529035460868-A887EA3STA6LTBFH0DBF/bake-baked-basil-236798.jpg</image:loc>
      <image:title>Supper Studio Blog - Why we do what we do...</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/5/25/turmeric-cardamom-and-lemon-crepes</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1527309911851-LXALGVA2XI6OYO0Z4NJQ/IMG_9100.jpg</image:loc>
      <image:title>Supper Studio Blog - Turmeric, Cardamom, and Lemon Crepes</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1527310016122-3JBJM5DVOMTB2WRRXR9G/IMG_9102.jpg</image:loc>
      <image:title>Supper Studio Blog - Turmeric, Cardamom, and Lemon Crepes</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/4/29/the-gift-of-time</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-05-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1525893580074-AQNHVIFDFSH57SK3X8OS/IMG_8972.JPG</image:loc>
      <image:title>Supper Studio Blog - The Gift of Time.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1525893652898-5QUMM8SD2MWI7KY9NHYA/IMG_8973.JPG</image:loc>
      <image:title>Supper Studio Blog - The Gift of Time.</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/4/26/the-dilemma-of-leftovers</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-05-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1524884158512-501HLNLN4RJXRHSPYSRT/IMG_8864.JPG</image:loc>
      <image:title>Supper Studio Blog - The Dilemma of Leftovers</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1524884222799-VZK82MDM5M28EXO1XOLK/IMG_8863.JPG</image:loc>
      <image:title>Supper Studio Blog - The Dilemma of Leftovers</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2018/4/11/the-wish-of-a-lifetime</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-05-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1523504209326-224EJGV45MG6LZ6KG1ED/IMG_8628.jpg</image:loc>
      <image:title>Supper Studio Blog - The Wish of a Lifetime</image:title>
      <image:caption>Beautiful Cailyn and Lori, waiting for a diagnosis in August 2016.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1523504483774-BHWIVK4LMXIECYRWKBTH/Resized_20180326_133210.jpeg</image:loc>
      <image:title>Supper Studio Blog - The Wish of a Lifetime - Beef Wellington</image:title>
      <image:caption>Beef Wellington made by Chef Cailyn with assistance from Chef Gordon Ramsay.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1523571348404-XJE697G0J3OLJSYEW5V9/20180326_135056.jpg</image:loc>
      <image:title>Supper Studio Blog - The Wish of a Lifetime</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/2017/7/19/example-post-two</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-06-16</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/category/Recipes</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/category/Salads</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/category/Breads</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/mason+jar+desserts</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/lunch+ideas</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/mexican</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/zucchini</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/easy+bread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/school+lunches</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/quiche</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/bbq</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/meal+prep</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/Peach+Crisp</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/quick+bread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/mason+jar+peach+crisp</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/breakfast</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/blog/tag/easy+sides</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-26</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/taco-perogy-casserole</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-10</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/32b6aad6-6df6-4dc8-8816-b8d88ed00e90/tacobeefperogies.jpg</image:loc>
      <image:title>May Menu Data - Taco Perogy Casserole</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/rosemary-mushroom-chicken-gnocchi</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682033846619-982W5OUVTP1XJP8XFT6O/rosemarymushroomchickengnocchi.jpg</image:loc>
      <image:title>May Menu Data - Rosemary Mushroom Chicken Gnocchi</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/southwestern-chicken-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-12</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682197227845-0P5LEEI0HWZUUWHLYKCA/southwesternchickenskilletweb.jpg</image:loc>
      <image:title>May Menu Data - Southwestern Chicken Skillet</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/cilantro-lime-chicken-tacos</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682197776299-96BSMHLRTN3DRJ6NXX7R/cilantrolimechickentacos.jpg</image:loc>
      <image:title>May Menu Data - Cilantro Lime Chicken Tacos</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/peanut-chicken-satay</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682198458417-XKHGGANKMD05FSP3G26W/peanutsataychickenwithcoconutrice.jpg</image:loc>
      <image:title>May Menu Data - Peanut Chicken Satay with Coconut Rice</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/turkey-veggie-breakfast-bake</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682263835614-50YGZWMOXOML4N7917JM/turkeyveggiebreakfastbake.jpg</image:loc>
      <image:title>May Menu Data - Turkey Veggie Breakfast Bake</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/italian-sausage-asparagus-orzo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/4d040fc6-4c5c-4c5f-8c01-3f362613d739/italiansausageasparagusorzo.jpg</image:loc>
      <image:title>May Menu Data - Italian Sausage and Asparagus Orzo</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/shrimp-creamy-penne</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682265757893-CCXN5NVHB8YGMYSC11X1/shrimppastawithgarlictomatocreamsauce.jpg</image:loc>
      <image:title>May Menu Data - Shrimp with Creamy Garlic Tomato Penne</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/cheeseburger-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682262195242-ND0EKXS4EDC69ZEYZCDH/cheeseburgerskillet.jpg</image:loc>
      <image:title>May Menu Data - Cheeseburger Skillet Casserole</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/lemongrass-beef</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682263087027-F2UDV8O5ZA563DZBQVTS/lemongrassbeef.jpg</image:loc>
      <image:title>May Menu Data - Lemongrass Beef with Rice</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/kung-pao-mushrooms</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-04-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682266953619-S8FL57E4YM78V4L7IQVU/kungpaomushrooms-2.jpg</image:loc>
      <image:title>May Menu Data - Kung Pao Mushrooms</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/may-menu-data/gnocchi-lemon-veggies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682266638189-6U60CQJRTSBTXZXPAFH3/gnocchiwithlemonandveggies-2.jpg</image:loc>
      <image:title>May Menu Data - Gnocchi with Lemon and Veggies</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-19</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/roseamary-cream-pork-chops</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684674813942-AE2QGVSRHCS1BFN25HOS/rosemarycreamporkchops-2.jpg</image:loc>
      <image:title>June Menu Data - Rosemary Cream Pork Chops with Rice</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/chorizo-burrito-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1621617012429-L61O83JSZJLVW2IOI2UI/Chorizoburritobowl.jpg</image:loc>
      <image:title>June Menu Data - Chorizo Burrito Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/greek-pork-pitas</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684675482336-41UHZJIO7DQOZ4J4R9C3/greekporkpitas-2.jpg</image:loc>
      <image:title>June Menu Data - Greek Pork Pitas</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/maple-ginger-cashew-chicken-stirfry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676065850-XF5I1T13TC7G5R0TPKP1/maplegingerchickencashewstirfry.jpg</image:loc>
      <image:title>June Menu Data - Maple Ginger Cashew Chicken Stirfry</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/lemon-chicken-asparagus-orzo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676513703-CP0H5AC1N1GQV3IS33B4/lemonchickenandaspargusorzo.jpg</image:loc>
      <image:title>June Menu Data - Lemon Chicken and Asparagus Orzo</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/mango-coconut-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1628515745030-HJ2RN8D27U304EKB03E9/mangococonut.jpg</image:loc>
      <image:title>June Menu Data - Mango Coconut Chicken</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/thai-shrimp-noodle-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677273084-Y8Z49C4TAXZ1XYL2MIIQ/thaishrimpnoodlebowl.jpg</image:loc>
      <image:title>June Menu Data - Thai Shrimp Noodle Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/asian-beef-ramen</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677939209-NBI2QUX9G6S1GUQLTXY3/asianbeeframen.jpg</image:loc>
      <image:title>June Menu Data - Asian Beef Ramen</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/philly-cheesesteak-noodle-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679296486-ARS0EI5GE56WT0V5BVLR/Phillycheesesteaknoodleskillet.jpg</image:loc>
      <image:title>June Menu Data - Philly Cheesesteak Noodle Skillet</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/creamy-beef-shells</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679653095-WA7A3R8IDWQPKJNR7HWP/creamybeefandshells.jpg</image:loc>
      <image:title>June Menu Data - Creamy Beef and Shells</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/three-cheese-spinach-mushroom-flatbread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684681119261-LPR02S8DUR8G0794IOXG/3cheesespinachmushroomflatbread.jpg</image:loc>
      <image:title>June Menu Data - Three Cheese Spinach, Mushroom and Pesto Flatbread</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/june-menu-data/three-cheese-spinach-mushroom-flatbread-wwk3l</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684680599461-VW00AGCRTIK1LUVCDKR8/springrollnoodlebowl.jpg</image:loc>
      <image:title>June Menu Data - Spring Roll Inspired Noodle Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscriptions</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-01-03</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500058415985-12TXY32SPNI5JG0U4J9E/SS_NewsletterBackground.png</image:loc>
      <image:title>Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1569350190489-WD0VGBNIOWC3IL4ERKSV/date.png</image:loc>
      <image:title>Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568566486306-9TP0QGCEDNJDF7CLXNUM/money%2Bicon.png</image:loc>
      <image:title>Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521957714602-MM72M5BFNY12XHCSKQ6R/food+icon.png</image:loc>
      <image:title>Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568566600091-V1LDQEJUOQ1HYPR5DTER/bag%2Bicon.png</image:loc>
      <image:title>Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521996697092-BPC4KABA51E1FYH9KZ0K/supper-studio-gift-certificate.png</image:loc>
      <image:title>Subscriptions - give the gift of supper</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1578232177232-ZRJZ3FTOPPQ45D7DDWUG/SS4.jpg</image:loc>
      <image:title>Subscriptions - supper studio meal Kit subscriptions</image:title>
      <image:caption>Easy &amp; Delicious, Now even more convenient</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2024-04-19</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/sweet-apple-salad-4n322</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6e324833-2c87-4db7-bf5b-a2d7375e6f87/dillpickleveggiepastasalad.jpg</image:loc>
      <image:title>Fresh Extras - Dill Pickle Veggie Pasta Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/sweet-apple-salad-4n322-83h9z</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/46ebfec5-11e3-4ef1-ad70-377cd8c13308/blackbeanandcornsalad.jpg</image:loc>
      <image:title>Fresh Extras - Black Bean and Corn Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/sweet-apple-salad-4n322-83h9z-kjmlc</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/ecc1dafd-15bf-4c4b-a677-2d013252886f/roastedpotatosalad.jpg</image:loc>
      <image:title>Fresh Extras - Roasted Potato Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/fiesta-taco-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/add0f9e1-0237-4435-af7a-4fa619734caf/fiestatacosalad.jpg</image:loc>
      <image:title>Fresh Extras - Fiesta Taco Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/dill-pickle-pasta</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-01-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6657f353-52d1-48ef-8bae-01f7aeeeeef7/dillpicklepastasalad.jpg</image:loc>
      <image:title>Fresh Extras - Dill Pickle Pasta Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/creamy-greek</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/9c9824f1-e1ad-43fa-b471-760c3c7cce7d/creamygreeksalad.jpg</image:loc>
      <image:title>Fresh Extras - Creamy Greek Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/fresh-extras/broccoli-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2024-08-25</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1661092808451-9SQ3VFMK2NOXXEUEX1IH/broccolisalsad.jpg</image:loc>
      <image:title>Fresh Extras - Broccoli Salad - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/new-blog</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-06-10</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/new-blog/stampede</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-10</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/supper-studio</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2018-04-02</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/contact</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-11</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/faq</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2024-08-25</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/style-guide</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2017-07-14</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1500053514270-SZZTE4NXP97009I72H8R/image-asset.jpeg</image:loc>
      <image:title>Style Guide - Heading Here</image:title>
      <image:caption>Subheading Here</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/the-dish</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2022-07-10</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521916504841-LQI3LX0JMYSLKAOG75P9/the-dish-header.jpg</image:loc>
      <image:title>Our Blog - the dish</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521863214151-GEAEOBYY8446DSXNCFNY/PatternBanner+%281%29.png</image:loc>
      <image:title>Our Blog</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/order</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521666286572-ALM8LBV01VQFJCTQ3R4V/PatternBanner+%281%29.png</image:loc>
      <image:title>Feed Me - Step One</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/copy-of-feed-me-funnel-delivery-step-two</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-05-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521667954156-HUU7JCTRZA4BRA0D7RI3/PatternBanner+%281%29.png</image:loc>
      <image:title>Feed Me - Delivery - Step Two</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/current-meals</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-06-13</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521866366326-QDCAEVEBP59K1Z3N3ASQ/current-meals.jpg</image:loc>
      <image:title>Current Meals - current meals</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521866030878-9U7BXGU09OTDQUR2VFOR/PatternBanner+%281%29.png</image:loc>
      <image:title>Current Meals</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/11e90652-d2d3-403d-b9f0-15a3f60191b1/downloadfreezermealrecipe.jpg</image:loc>
      <image:title>Current Meals - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-pickup-step-two</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-02-20</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521667954156-HUU7JCTRZA4BRA0D7RI3/PatternBanner+%281%29.png</image:loc>
      <image:title>Feed Me - Pick Up - Step Two</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629719283541-YFF947QUXV4KWE2M9P1Z/lunchkitswebplaceholder.jpg</image:loc>
      <image:title>Feed Me - Pick Up - Step Two - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1545785666622-3KUGJAV3OH4MGT6Z4RI6/dinners.jpg</image:loc>
      <image:title>Feed Me - Pick Up - Step Two</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/camping-survival</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-08-03</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1556982632942-WASACIY9FDJ2P5J7ZPVV/trailercamping.jpg</image:loc>
      <image:title>Camping Survival Kits - camping survival kits</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537762035378-L9N22JCL75NAODCSPKVI/bann</image:loc>
      <image:title>Camping Survival Kits</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/thanksgiving</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-09-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537841016382-YY5514DE2OEPMZY476XG/IMG_0170.JPG</image:loc>
      <image:title>Thanksgiving Survival - Thanks-giving survival menu</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-pick-up-month-option</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-08-22</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1521667954156-HUU7JCTRZA4BRA0D7RI3/PatternBanner+%281%29.png</image:loc>
      <image:title>Feed Me - Pick Up - Month Option</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1629636895575-YICA5JML6ZBP7EE1G9SN/septembermonthmenuchoice.jpg</image:loc>
      <image:title>Feed Me - Pick Up - Month Option</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627305224824-IUN8MJ9SURA1F0GYZP5G/augustmenu.jpg</image:loc>
      <image:title>Feed Me - Pick Up - Month Option</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-kit-order-form-november</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-10-25</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - NOVEMBER</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-october</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-10-07</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - OCTOBER</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/terms-conditions-subscriptions</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2024-01-06</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1569348841823-OR55A07O4OSPVF4C3TLN/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Terms &amp; Conditions - Subscriptions</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1569356328274-MMU19O4ISZIIQD9J0V6Z/SS-Subscription-Cut-off.jpg</image:loc>
      <image:title>Terms &amp; Conditions - Subscriptions</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-december</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-11-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - DECEMBER</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-january</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-01-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - JANUARY</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-february</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-02-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - FEBRUARY</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-march</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - MARCH</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-april</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - APRIL</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-may</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-03</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - MAY</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-june</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - JUNE</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-july</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-06-10</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - JULY</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-august</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-07-22</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - AUGUST</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/subscription-meal-order-form-september</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-08-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568571966996-A5CC6HSY3H2Q0I8YNYOW/PatternBanner%2B%281%29.png</image:loc>
      <image:title>Subscription Meal Order Form - SEPTEMBER</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/testimonials</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-08-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783213313-XUOFKNH9RDVQE8L9OCCK/IMG_5553.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783213312-9ABXLAX0MJVHNU7AYP2X/IMG_5554.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783213939-ABCPLOCW5Y5MTBOGBB0R/IMG_5556.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783214143-NES2AKUZTK6ZU416G404/IMG_5557.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783214578-OL1PS0Q1U76FWTYL2WIT/IMG_5558.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783214861-ZH7V07JWDZFBB2Y8IHGI/IMG_5559.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783215219-UEM47UZ8WGQQGK7A9BBN/IMG_5560.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783215718-XHREUEKS05CIECKDUPYH/IMG_5561.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783215925-4RXRLOX9VD71QYC8D5PE/IMG_5562.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783216527-9GL3QIM3JFXI7UY4VNPZ/IMG_5563.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783216734-QPRPE3ROEGF2KJOL8TMO/IMG_5564.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783217190-1AL6C3SE0LK8EAB7EQ5G/IMG_5565.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783217390-X0UFHUJFOVGM729WDVKD/IMG_5566.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783217874-8CDEYQDXY34QCK439QNG/IMG_5567.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783218041-CV2MK549MHPTT9FRQMH7/IMG_5568.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783218453-3ZLCRJ7JAG6IE41BE09N/IMG_5569.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627783218643-5HAC2JXX627MPFNQJAW5/IMG_5593.jpg</image:loc>
      <image:title>Testimonials</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/care-packages</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/c6440cf9-8c30-4dd5-9cd6-b8dbd4f17232/IMG_3961.JPG</image:loc>
      <image:title>Care Packages - care packages</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537762035378-L9N22JCL75NAODCSPKVI/bann</image:loc>
      <image:title>Care Packages</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6c85967b-fd0f-46ed-8052-9df1ccd0debc/IMG_3960.jpg</image:loc>
      <image:title>Care Packages - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/just-baked-cake-jars</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/31ed0223-ba6a-444e-a348-8bd0a9dc1581/supperstudio.jpg</image:loc>
      <image:title>Just Baked Cake Jars - just baked Cake Jars</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537762035378-L9N22JCL75NAODCSPKVI/bann</image:loc>
      <image:title>Just Baked Cake Jars</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/just-baked-cake-jars-gift-giving</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-10-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/605d6c7b-fb08-453a-8a6f-cdd20f43be9e/IMG_8739.jpg</image:loc>
      <image:title>Just Baked Cake Jars - Gift Giving Bulk Purchase - Bulk/ corporate Purchase Program</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537762035378-L9N22JCL75NAODCSPKVI/bann</image:loc>
      <image:title>Just Baked Cake Jars - Gift Giving Bulk Purchase</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/8aa1f308-5c08-4582-b053-0354546ba2a1/IMG_6726.jpg</image:loc>
      <image:title>Just Baked Cake Jars - Gift Giving Bulk Purchase - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/christmas-survival</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-11-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537841016382-YY5514DE2OEPMZY476XG/IMG_0170.JPG</image:loc>
      <image:title>Christmas Survival - Christmas survival menu</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/easter-survival</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-03-25</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537841016382-YY5514DE2OEPMZY476XG/IMG_0170.JPG</image:loc>
      <image:title>Easter Survival - Easter survival menu</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/gift-certificates</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-11-17</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/gift-certificates/alberta-dance-academy-fundraiser</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-11-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637185131153-MZPNIDB5DRZTT1L1CEEO/30+BLACK+ADA+Circle+Logo.png</image:loc>
      <image:title>Gift Certificates - Alberta Dance Academy Fundraiser</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/gift-certificates/wickstrom-gift-certificates</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2023-02-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1668516871811-WNG6XSP10HMG604HU6BR/wickstromgc.jpg</image:loc>
      <image:title>Gift Certificates - Wickstrom Gift Certificates</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/gift-certificates/bradbury-gift-certificates</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2023-02-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1677466102987-OI7LYVGWP6FSOUCVAY2W/bradburymealcertificates.jpg</image:loc>
      <image:title>Gift Certificates - Bradbury Gift Certificates</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/gift-certificates/gift-card</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-04</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1607576106421-7PL11ZCGKCAE84DTQGPH/25giftcertv2.jpg</image:loc>
      <image:title>Gift Certificates - Gift Card</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1607576129086-UR68PHPYQ1VV6M7PS4VB/50giftcertv2.jpg</image:loc>
      <image:title>Gift Certificates - Gift Card</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-11-15</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/seniors-and-singles</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1667737419853-IJ3BWW0V4NWR7RSDB8Z4/seniorsandsingles.JPG</image:loc>
      <image:title>Care Packages - Seniors and Singles Care Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/get-well-soon-package</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637012114482-2A1VUJ7BZQ1U3MWXXSGZ/getwellsoonpackage.JPG</image:loc>
      <image:title>Care Packages - Get Well Soon Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/housewarming-package</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2024-10-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637012095079-H501O98J2UFNVY69CCB0/housewarmingpackage.JPG</image:loc>
      <image:title>Care Packages - Housewarming Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/grief-package</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-07-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637012065906-E3EMWNSX4DDU2EP94A58/griefcarepackage.JPG</image:loc>
      <image:title>Care Packages - Grief Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/staycation-meal-package</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637012028340-68DCOY7WHPZV8DEKE2FL/staycationpackage.JPG</image:loc>
      <image:title>Care Packages - Staycation Meal Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/feed-me-packages/new-parent-package</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1636578439585-PNFZVGKY1333NPFPLKZQ/newparentpackageimage.jpg</image:loc>
      <image:title>Care Packages - New Parent Care Package</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-24</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/weeknight-grill-kit</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/a937848a-c3b3-4b2c-a46e-c64a5977083b/weekendbbqkit.JPG</image:loc>
      <image:title>Delivery - June Menu - Weeknight Grill Kit</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/chorizo-burrito-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1621617012429-L61O83JSZJLVW2IOI2UI/Chorizoburritobowl.jpg</image:loc>
      <image:title>Delivery - June Menu - Chorizo Burrito Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/greek-pork-pitas</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684675482336-41UHZJIO7DQOZ4J4R9C3/greekporkpitas-2.jpg</image:loc>
      <image:title>Delivery - June Menu - Greek Pork Pitas</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/maple-ginger-cashew-chicken-stirfry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676065850-XF5I1T13TC7G5R0TPKP1/maplegingerchickencashewstirfry.jpg</image:loc>
      <image:title>Delivery - June Menu - Maple Ginger Cashew Chicken Stirfry</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/lemon-chicken-asparagus-orzo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-17</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676513703-CP0H5AC1N1GQV3IS33B4/lemonchickenandaspargusorzo.jpg</image:loc>
      <image:title>Delivery - June Menu - Lemon Chicken and Asparagus Orzo</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/mango-coconut-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1628515745030-HJ2RN8D27U304EKB03E9/mangococonut.jpg</image:loc>
      <image:title>Delivery - June Menu - Mango Coconut Chicken</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/thai-shrimp-noodle-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677273084-Y8Z49C4TAXZ1XYL2MIIQ/thaishrimpnoodlebowl.jpg</image:loc>
      <image:title>Delivery - June Menu - Thai Shrimp Noodle Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/asian-beef-ramen</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-21</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677939209-NBI2QUX9G6S1GUQLTXY3/asianbeeframen.jpg</image:loc>
      <image:title>Delivery - June Menu - Asian Beef Ramen</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/philly-cheesesteak-noodle-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679296486-ARS0EI5GE56WT0V5BVLR/Phillycheesesteaknoodleskillet.jpg</image:loc>
      <image:title>Delivery - June Menu - Philly Cheesesteak Noodle Skillet</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/creamy-beef-shells</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-23</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679653095-WA7A3R8IDWQPKJNR7HWP/creamybeefandshells.jpg</image:loc>
      <image:title>Delivery - June Menu - Creamy Beef and Shells</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/three-cheese-spinach-mushroom-flatbread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684681244110-TC5TDN65Y1Q9EU1UAUIS/3cheesespinachmushroomflatbread.jpg</image:loc>
      <image:title>Delivery - June Menu - Three Cheese Spinach, Mushroom and Pesto Flatbread</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/spring-roll-noodle-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684680599461-VW00AGCRTIK1LUVCDKR8/springrollnoodlebowl.jpg</image:loc>
      <image:title>Delivery - June Menu - Spring Roll Noodle Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/rosemary-cream-pork-chops</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684674813942-AE2QGVSRHCS1BFN25HOS/rosemarycreamporkchops-2.jpg</image:loc>
      <image:title>Delivery - June Menu - Rosemary Cream Pork Chops with Rice - rosemarycreamporkchops-2.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/power-cookies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1631459658715-BHB68L8VV68PNS1ONU57/powercookies.jpg</image:loc>
      <image:title>Delivery - June Menu - Power Cookies</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/power-bites</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1651172143742-QDBNE6AIQI6OTS681WZ1/powerbites.jpg</image:loc>
      <image:title>Delivery - June Menu - Power Bites</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/breakfast-burritos</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609694777870-8PZVG9SMLB2RH1142R3F/breakfastburritos.jpg</image:loc>
      <image:title>Delivery - June Menu - Breakfast Burritos</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/seasoned-shredded-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1632481025349-TMACDIHBFXPMLAGD1OSR/shreddedchickenwebpic.jpg</image:loc>
      <image:title>Delivery - June Menu - Seasoned Shredded Chicken</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/single-serves</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/07cbf937-9376-4663-825f-53dc511d8830/heatandeatsingleserves.jpg</image:loc>
      <image:title>Delivery - June Menu - Heat and Eat Single Serves - heatandeatsingleserves.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/fresh-extras-black-bean-and-corn-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627496915843-ZSYCAELF41NYB5R8LHW5/blackbeanandcornsalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Fresh Extra - Black Bean and Corn Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/creamy-greek-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/9c9824f1-e1ad-43fa-b471-760c3c7cce7d/creamygreeksalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Fresh Extra - Creamy Greek Salad - creamygreeksalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/fiesta-taco-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/add0f9e1-0237-4435-af7a-4fa619734caf/fiestatacosalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Fresh Extra - Fiesta Taco Salad - fiestatacosalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/fresh-extra-broccoli-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627308031941-YZWUYLASJBFF1CEUU4QB/broccolisalsad.jpg</image:loc>
      <image:title>Delivery - June Menu - Fresh Extra - Broccoli Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/roasted-potato-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/ecc1dafd-15bf-4c4b-a677-2d013252886f/roastedpotatosalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Fresh Extra - Roasted Potato Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/dill-veggie-pasta-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6e324833-2c87-4db7-bf5b-a2d7375e6f87/dillpickleveggiepastasalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Dill Veggie Pasta Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-june/dill-veggie-pasta-salad-a8hyw</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6657f353-52d1-48ef-8bae-01f7aeeeeef7/dillpicklepastasalad.jpg</image:loc>
      <image:title>Delivery - June Menu - Dill Pickle Pasta Salad - dillpicklepastasalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/camping-survival-kits-data</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-06-30</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-12-01</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/just-baked-cake-jars-fall-flavors</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-09-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298343398-SOTE9ASE1UCYHEJUW4HH/IMG_7163-2.jpg</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298045003-H801J8B0FX8HYJVG2Q3O/11BC51D2-41F5-42C9-8D85-6EB773109465.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298045183-7BKN2BQDLUP60CL02LOX/A1888143-356C-4181-882E-97A7636D44BA.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298045098-QLD5EO7WWGRTSYX93QBC/B0F60D84-35E4-4FDB-AC8A-0FC0326B3573.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298044879-QF1WF7VE1LUL7VF87H8S/B4648EF7-8765-4EEA-9296-6CEE171666FA.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298045048-0RHBK0GZ4X8JKPG0M2SH/DA6A86BE-2A81-4532-9B91-1774BA6FF0B2.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298079785-M6HN7MLYRZMUR48XMB0A/CFD3A1FE-617F-4249-AC89-E3B8E88E3BAC.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1695298200835-QBF8FXCC7F554613P5LB/AD3A4CD7-4845-45C5-A8D6-40F8757B0308.PNG</image:loc>
      <image:title>Holiday Survival - items - Just Baked Cake Jars - Holiday Flavors</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/cinnamon-streusel-french-toast-casserole</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1638365971205-AMUI8MBJ3D1ECXJKCMCA/cinnamonstreuselfrenchtoast.jpg</image:loc>
      <image:title>Holiday Survival - items - Cinnamon Streusel French Toast Casserole</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/roasted-brussel-sprouts-with-bacon</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537842808505-S5V4ADMXBBXWPM6KH56Q/brussels-2.jpg</image:loc>
      <image:title>Holiday Survival - items - Roasted Brussel Sprouts with Bacon</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/ultimate-twice-baked-potatoes</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1600661334080-CR7FF380DU2QVMMRVV5X/partypotatoes.jpg</image:loc>
      <image:title>Holiday Survival - items - Party Potatoes</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/pecan-cinnamon-streusel-sweet-potato-casserole</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1575432090560-YMTJB1VWIGTWHSZ6XEVQ/pecancinnamonsweetpotato.jpg</image:loc>
      <image:title>Holiday Survival - items - Pecan Cinnamon Streusel Sweet Potato Casserole</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/spinach-artichoke-dip</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1544053416020-IFAYA63JG2ODQ3K1THD6/spinachartichokedip.jpg</image:loc>
      <image:title>Holiday Survival - items - Spinach Artichoke Dip</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/buffalo-chicken-dip</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537842661356-1ZEJ57N0KE7OAK8U5V5W/buffalo+dip.jpg</image:loc>
      <image:title>Holiday Survival - items - Buffalo Chicken Dip</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/crockpot-sausage-stuffing</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537843005144-COYYBKP4T2HLEXJXC6XY/sausagestuffing.jpg</image:loc>
      <image:title>Holiday Survival - items - Crockpot Sausage Stuffing</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/holiday-survival-data/fresh-dinner-rolls</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-12-15</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1537842632262-FETLJRU4I7DVUBJDPSD2/dinner+buns.jpg</image:loc>
      <image:title>Holiday Survival - items - Fresh Dinner Rolls</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-26</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/rosemary-mushroom-chicken-gnocchi</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682034484169-4Q4H2HRV6MGTC998R4F9/rosemarymushroomchickengnocchi.jpg</image:loc>
      <image:title>Pick Up - May Menu - Rosemary Mushroom Chicken Gnocchi - rosemarymushroomchickengnocchi.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/gnocchi-lemon-veggies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682266638189-6U60CQJRTSBTXZXPAFH3/gnocchiwithlemonandveggies-2.jpg</image:loc>
      <image:title>Pick Up - May Menu - Gnocchi with Lemon and Veggies - gnocchiwithlemonandveggies-2.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/southwestern-chicken-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682197227845-0P5LEEI0HWZUUWHLYKCA/southwesternchickenskilletweb.jpg</image:loc>
      <image:title>Pick Up - May Menu - Southwestern Chicken Skillet - southwesternchickenskilletweb.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/cilantro-lime-chicken-taco</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682197776299-96BSMHLRTN3DRJ6NXX7R/cilantrolimechickentacos.jpg</image:loc>
      <image:title>Pick Up - May Menu - Cilantro Lime Chicken Tacos - cilantrolimechickentacos.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/peanut-chicken-satay-with-coconut-rice</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682198458417-XKHGGANKMD05FSP3G26W/peanutsataychickenwithcoconutrice.jpg</image:loc>
      <image:title>Pick Up - May Menu - Peanut Chicken Satay with Coconut Rice - peanutsataychickenwithcoconutrice.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/turkey-veggie-breakfast-bake</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682263835614-50YGZWMOXOML4N7917JM/turkeyveggiebreakfastbake.jpg</image:loc>
      <image:title>Pick Up - May Menu - Turkey Veggie Breakfast Bake - turkeyveggiebreakfastbake.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/italian-sausage-asparagus-orzo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/4d040fc6-4c5c-4c5f-8c01-3f362613d739/italiansausageasparagusorzo.jpg</image:loc>
      <image:title>Pick Up - May Menu - Italian Sausage and Asparagus Orzo - italiansausageasparagusorzo.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/shrimp-creamy-garlic-tomato-penne</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1658590894439-UW31GESDKN2XQZUPQZMR/shrimpgarlictomatocreamsauce.jpg</image:loc>
      <image:title>Pick Up - May Menu - Shrimp with Creamy Garlic Tomato Penne - shrimpgarlictomatocreamsauce.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/cheeseburger-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682262195242-ND0EKXS4EDC69ZEYZCDH/cheeseburgerskillet.jpg</image:loc>
      <image:title>Pick Up - May Menu - Cheeseburger Skillet - cheeseburgerskillet.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/lemongrass-beef</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682263087027-F2UDV8O5ZA563DZBQVTS/lemongrassbeef.jpg</image:loc>
      <image:title>Pick Up - May Menu - Lemongrass Beef with Rice - lemongrassbeef.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/kung-pao-mushrooms</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682266953619-S8FL57E4YM78V4L7IQVU/kungpaomushrooms-2.jpg</image:loc>
      <image:title>Pick Up - May Menu - Kung Pao Mushrooms - kungpaomushrooms-2.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/taco-beef-perogy</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682262689146-O92CG8VV3EKHKKX56OXF/tacobeefperogies.jpg</image:loc>
      <image:title>Pick Up - May Menu - Taco Perogy Casserole - tacobeefperogies.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/heat-and-eat-single-serves</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/07cbf937-9376-4663-825f-53dc511d8830/heatandeatsingleserves.jpg</image:loc>
      <image:title>Pick Up - May Menu - Heat and Eat Single Serves</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/heat-and-eat-soups</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/22643f5a-f038-4dfb-b5fb-f5219fa41d04/heatandeatsoups.jpg</image:loc>
      <image:title>Pick Up - May Menu - Heat and Eat Soups</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/seasoned-shredded-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1632481025349-TMACDIHBFXPMLAGD1OSR/shreddedchickenwebpic.jpg</image:loc>
      <image:title>Pick Up - May Menu - Seasoned Shredded Chicken</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/power-cookies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1631459658715-BHB68L8VV68PNS1ONU57/powercookies.jpg</image:loc>
      <image:title>Pick Up - May Menu - Power Cookie</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/power-cookies-gm4bb</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1651172143742-QDBNE6AIQI6OTS681WZ1/powerbites.jpg</image:loc>
      <image:title>Pick Up - May Menu - Power Bites</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/creamy-greek-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/9c9824f1-e1ad-43fa-b471-760c3c7cce7d/creamygreeksalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Creamy Greek Salad - creamygreeksalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/broccoli-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1661092689473-ODH5CNOZ99XEGTSNMMRC/broccolisalsad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Broccoli Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/breakfast-burritos</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609694777870-8PZVG9SMLB2RH1142R3F/breakfastburritos.jpg</image:loc>
      <image:title>Pick Up - May Menu - Breakfast Burritos</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/roasted-potato-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/ecc1dafd-15bf-4c4b-a677-2d013252886f/roastedpotatosalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Roasted Potato Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/dill-pickle-veggie-pasta-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6e324833-2c87-4db7-bf5b-a2d7375e6f87/dillpickleveggiepastasalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Dill Pickle Veggie Pasta Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/dill-pickle-veggie-pasta-salad-fjaz7</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6657f353-52d1-48ef-8bae-01f7aeeeeef7/dillpicklepastasalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Dill Pickle Pasta Salad - dillpicklepastasalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/fiesta-taco-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/add0f9e1-0237-4435-af7a-4fa619734caf/fiestatacosalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Fiesta Taco Salad - fiestatacosalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-may/mexican-corn-black-bean</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627496915843-ZSYCAELF41NYB5R8LHW5/blackbeanandcornsalad.jpg</image:loc>
      <image:title>Pick Up - May Menu - Mexican Corn and Black Bean Salad - blackbeanandcornsalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-05-24</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/chorizo-burrito-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1621617012429-L61O83JSZJLVW2IOI2UI/Chorizoburritobowl.jpg</image:loc>
      <image:title>Pick Up - June Menu - Chorizo Burrito Bowl</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/greek-pork-pitas</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684675482336-41UHZJIO7DQOZ4J4R9C3/greekporkpitas-2.jpg</image:loc>
      <image:title>Pick Up - June Menu - Greek Pork Pitas - greekporkpitas-2.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/maple-ginger-cashew-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676065850-XF5I1T13TC7G5R0TPKP1/maplegingerchickencashewstirfry.jpg</image:loc>
      <image:title>Pick Up - June Menu - Maple Ginger Cashew Chicken Stirfry - maplegingerchickencashewstirfry.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/lemon-chicken-asparagus-orzo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676513703-CP0H5AC1N1GQV3IS33B4/lemonchickenandaspargusorzo.jpg</image:loc>
      <image:title>Pick Up - June Menu - Lemon Chicken and Asparagus Orzo - lemonchickenandaspargusorzo.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/mango-coconut-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684676871840-HJ0BMUXZXUIUIJNG74GE/mangococonutchicken.jpg</image:loc>
      <image:title>Pick Up - June Menu - Mango Coconut Chicken - mangococonutchicken.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/thai-shrimp-noodle-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677273084-Y8Z49C4TAXZ1XYL2MIIQ/thaishrimpnoodlebowl.jpg</image:loc>
      <image:title>Pick Up - June Menu - Thai Shrimp Noodle Bowl - thaishrimpnoodlebowl.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/asian-beef-ramen</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684677939209-NBI2QUX9G6S1GUQLTXY3/asianbeeframen.jpg</image:loc>
      <image:title>Pick Up - June Menu - Asian Beef Ramen - asianbeeframen.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/philly-cheesesteak-noodle-skillet</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679296486-ARS0EI5GE56WT0V5BVLR/Phillycheesesteaknoodleskillet.jpg</image:loc>
      <image:title>Pick Up - June Menu - Philly Cheesesteak Noodle Skillet - Phillycheesesteaknoodleskillet.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/creamy-beef-and-shells</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684679653095-WA7A3R8IDWQPKJNR7HWP/creamybeefandshells.jpg</image:loc>
      <image:title>Pick Up - June Menu - Creamy Beef and Shells - creamybeefandshells.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/spinach-mushroom-flatbread</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684681244110-TC5TDN65Y1Q9EU1UAUIS/3cheesespinachmushroomflatbread.jpg</image:loc>
      <image:title>Pick Up - June Menu - Three Cheese Spinach, Mushroom and Pesto Flatbread - 3cheesespinachmushroomflatbread.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/spring-roll-noodle-bowl</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684680599461-VW00AGCRTIK1LUVCDKR8/springrollnoodlebowl.jpg</image:loc>
      <image:title>Pick Up - June Menu - Spring Roll Inspired Noodle Bowl - springrollnoodlebowl.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/rosemary-cream-pork</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-11</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1684674813942-AE2QGVSRHCS1BFN25HOS/rosemarycreamporkchops-2.jpg</image:loc>
      <image:title>Pick Up - June Menu - Rosemary Cream Pork Chops with Rice - rosemarycreamporkchops-2.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/power-bites-1</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1651172143742-QDBNE6AIQI6OTS681WZ1/powerbites.jpg</image:loc>
      <image:title>Pick Up - June Menu - Power Bites</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/power-cookies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1631459658715-BHB68L8VV68PNS1ONU57/powercookies.jpg</image:loc>
      <image:title>Pick Up - June Menu - Power Cookies</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/breakfast-burritos</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1609694777870-8PZVG9SMLB2RH1142R3F/breakfastburritos.jpg</image:loc>
      <image:title>Pick Up - June Menu - Breakfast Burritos</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/seasoned-shredded-chicken</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1632481025349-TMACDIHBFXPMLAGD1OSR/shreddedchickenwebpic.jpg</image:loc>
      <image:title>Pick Up - June Menu - Seasoned Shredded Chicken</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/single-serves</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/07cbf937-9376-4663-825f-53dc511d8830/heatandeatsingleserves.jpg</image:loc>
      <image:title>Pick Up - June Menu - Heat and Eat Single Serves - heatandeatsingleserves.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/creamy-greek-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/9c9824f1-e1ad-43fa-b471-760c3c7cce7d/creamygreeksalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Creamy Greek Salad - creamygreeksalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/fiesta-taco-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/add0f9e1-0237-4435-af7a-4fa619734caf/fiestatacosalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Fiesta Taco Salad - fiestatacosalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/broccoli-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1632597461600-GN78W0AIJTTLCQU53KWZ/broccolisalsad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Fresh Extra - Broccoli Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/dill-veggie-pasta-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6e324833-2c87-4db7-bf5b-a2d7375e6f87/dillpickleveggiepastasalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Dill Veggie Pasta Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/dill-veggie-pasta-salad-egaal</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/6657f353-52d1-48ef-8bae-01f7aeeeeef7/dillpicklepastasalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Dill Pickle Pasta Salad - dillpicklepastasalad.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/black-bean-corn-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1627496864488-WT1BT7GV4YSQEM734Y07/blackbeanandcornsalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Fresh Extra - Mexican Black Bean and Corn Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/pickup-june/roasted-potato-salad</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-06-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/ecc1dafd-15bf-4c4b-a677-2d013252886f/roastedpotatosalad.jpg</image:loc>
      <image:title>Pick Up - June Menu - Fresh Extra - Roasted Potato Salad</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-options</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2020-06-04</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-options/delivery-options-june</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-06-09</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1545794238383-6MMJKOOB37LM8MO4PHAG/delivery-fee-MAROON.jpg</image:loc>
      <image:title>Delivery Options - Delivery Dates Available June</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/delivery-options/delivery-options-may</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-05-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1545794238383-6MMJKOOB37LM8MO4PHAG/delivery-fee-MAROON.jpg</image:loc>
      <image:title>Delivery Options - Delivery Dates Available May</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/meal-kit-subscriptions-okotoks</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-04-27</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/meal-kit-subscriptions-okotoks/monthly-subscription-2-mealsweek</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-09-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568568423920-ZGUZH4ZQVY59TU38QHII/Subscription-Image-2.jpg</image:loc>
      <image:title>Meal Kit Subscriptions Okotoks - Subscription - Okotoks</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1568568148887-BZ14XB98PJNH4EX9710S/Subscription-Image-3.jpg</image:loc>
      <image:title>Meal Kit Subscriptions Okotoks - Subscription - Okotoks</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1575863914783-MPS5GOY97LWBSUX3VBIO/4weeksubscription.jpg</image:loc>
      <image:title>Meal Kit Subscriptions Okotoks - Subscription - Okotoks</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/meal-kit-subscription-calgary</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2021-11-17</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/meal-kit-subscription-calgary/meal-kit-subscription-calgary</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-09-26</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637176434673-43EOGYHCVP0YNJNUYHLU/Subscription-Image-2.jpg</image:loc>
      <image:title>Meal Kit Subscription Calgary - Subscription Calgary</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1637178842286-2WSK9ARDMZXJ3R211KJ0/Subscription-Image-3.jpg</image:loc>
      <image:title>Meal Kit Subscription Calgary - Subscription Calgary</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/meal-kit-subscriptions-highriverokotoks10kradius</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2020-06-19</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/freezer-prep-bundle-data</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2022-08-16</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/freezer-prep-bundle-data/session-1</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2022-08-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1661311217232-ELC0O5KX4P0A2TR0BNUO/session1.jpg</image:loc>
      <image:title>Freezer Prep Bundle DATA - Fill Your Freezer Session #1 - Slowcooker Chicken Meals</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-10-22</lastmod>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/just-baked-cake-jars-bulk-buy</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/31ed0223-ba6a-444e-a348-8bd0a9dc1581/supperstudio.jpg</image:loc>
      <image:title>Cake Jars - Bulk Buy - Just Baked Cake Jars - supperstudio.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/celebrate</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/d8931d1d-713b-4a37-971c-2390dcae86b1/celebrate.jpg</image:loc>
      <image:title>Cake Jars - Celebrate - celebrate.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682267772096-JGO3LIDWNFQQWMPROT43/6C841F30-4183-475F-949F-CFF587BCB625.PNG</image:loc>
      <image:title>Cake Jars - Celebrate</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/saturday-morning-cartoons</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/526bd9e7-4df4-4aae-ab5e-f205f5001bfd/saturday.jpg</image:loc>
      <image:title>Cake Jars - Saturday Morning Cartoons - saturday.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/so-doughp</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/371fba87-2890-46ec-9846-dbbb40441aa8/sodoughp.jpg</image:loc>
      <image:title>Cake Jars - So Doughp - sodoughp.jpg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/24carrot</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1681216995943-UNWBBAABVW1O7NWSZ5DL/IMG_8730.JPG</image:loc>
      <image:title>Cake Jars - 24 Carrot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1679152682180-9LECUH3VLFQ5NICMY3WS/24carrot.PNG</image:loc>
      <image:title>Cake Jars - 24 Carrot</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/bey-cake</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1681217030364-0B3ERKO9SAPVDFBHQ5M6/IMG_8733.JPG</image:loc>
      <image:title>Cake Jars - Bey Cake</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1679152891765-88WOTLPFD3XQBERLM7BR/beycake.PNG</image:loc>
      <image:title>Cake Jars - Bey Cake</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/bubbling-with-excitement</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1681217054886-64VUTTXDNX1DHK9GVPHQ/IMG_8729.JPG</image:loc>
      <image:title>Cake Jars - Bubbling with Excitement</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1679152994571-01LQ6A4E99IGIPWWUOCN/bubbling.PNG</image:loc>
      <image:title>Cake Jars - Bubbling with Excitement</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/lemon-drop</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-02-28</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1681217142321-DAV13L082D3FHL1PT7VG/IMG_8731.JPG</image:loc>
      <image:title>Cake Jars - Lemon Drop</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1679153622485-HPKGZG1IM6MCSL6ERCLW/lemondrop.PNG</image:loc>
      <image:title>Cake Jars - Lemon Drop</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/ron-burgundy</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/449623f8-149f-4ce3-a2cc-9bf0f24796be/ron.jpg</image:loc>
      <image:title>Cake Jars - Ron Burgundy Red - ron.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279251921-F6XJEELI1XBOWDWDZFNE/61647B44-FC1D-433D-880F-3A6B274CF834.PNG</image:loc>
      <image:title>Cake Jars - Ron Burgundy Red</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/cookies-extreme</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/8e68dddf-a79f-4d88-a351-06293419dee2/extreme.jpg</image:loc>
      <image:title>Cake Jars - Cookies Extreme - extreme.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279366714-8PB8DRJEZS94IA8G5M3V/EDE78331-2FEE-409B-85D4-C897E9EEF432.PNG</image:loc>
      <image:title>Cake Jars - Cookies Extreme</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/the-bff</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/694e3c0d-c0e5-4b83-aed9-c929ceda3764/bff.jpg</image:loc>
      <image:title>Cake Jars - The BFF - bff.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279440704-NMVBXKA8QV9SQBVWQZST/C9DF5C52-4CA5-4401-B8AE-6A58440A76FA.PNG</image:loc>
      <image:title>Cake Jars - The BFF</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/get-twixy-with-it</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/fe444ab7-47f9-4aed-b99b-126c1fe6a547/twixy.jpg</image:loc>
      <image:title>Cake Jars - Get Twixy With It - twixy.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279551397-JAJFETTHIH7L6N69LYUM/317CFDE8-29B4-4105-A7FF-EB344A533D99.PNG</image:loc>
      <image:title>Cake Jars - Get Twixy With It</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/chocolate-fix</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/b289d28c-472b-485a-923c-c30dd5f6a4d1/fix.jpg</image:loc>
      <image:title>Cake Jars - Chocolate Fix - fix.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279673215-M1JL3Z3V01FHR3J72UAJ/C045A849-B2F6-4AE1-830F-2DDE2E822764.PNG</image:loc>
      <image:title>Cake Jars - Chocolate Fix</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/vegan-dance-if-we-want-to</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/42bceb7f-6fa8-40de-a862-dfdc0dd635f4/vegandance.jpg</image:loc>
      <image:title>Cake Jars - Vegan Dance if We want To - vegandance.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682279768246-15AIVX8UE10YBY92ZWA9/0BEC71E4-756A-4D21-B7AA-36FF88A1475F.PNG</image:loc>
      <image:title>Cake Jars - Vegan Dance if We want To</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/the-v-card</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/e59c596f-8d02-437f-a989-d27851af72d2/vcard.jpg</image:loc>
      <image:title>Cake Jars - The V Card - vcard.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682280002117-RN12LP6MDLZJVCPBNHGH/631F7E58-CA8E-42DB-BF80-3A5A04EC4071.PNG</image:loc>
      <image:title>Cake Jars - The V Card</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/espresso-yourself</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/504259d2-20f0-4a8e-ab9e-6aa86d0509e3/espresso.jpg</image:loc>
      <image:title>Cake Jars - Espresso Yourself - espresso.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682280154947-5O86AR3UI05SWEYCU33U/E592FBCD-5500-47BF-BACE-4415FE9824CC.PNG</image:loc>
      <image:title>Cake Jars - Espresso Yourself</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/ron-burgundy-gf</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2025-05-16</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682280270512-758CN8OIPCS4DN2KBEFH/C2A43B20-FE2F-4100-86D3-DABBFCA864D7.PNG</image:loc>
      <image:title>Cake Jars - Ron Burgundy Red  -GF</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://supperstudio.ca/cake-jars/chocolate-fix-gf</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-29</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/de12ff9a-ccb1-4e20-b4b5-819a6ba08f26/gffix.jpg</image:loc>
      <image:title>Cake Jars - Chocolate Fix - GF - gffix.jpg</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/59360595ff7c502e51f0e6e2/1682280315059-3LJBQLTCUPM9GL6C3C4E/3AB38BB9-2F57-4273-AFB3-3AA4F01C7113.PNG</image:loc>
      <image:title>Cake Jars - Chocolate Fix - GF</image:title>
    </image:image>
  </url>
</urlset>

